PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000021.1_g00046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TALE
Protein Properties Length: 530aa    MW: 58993 Da    PI: 5.238
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000021.1_g00046.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-094144511954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Itr_sc000021.1_g00046.1 414 FEHflHPYPKDSEKVTLARQTGLTRSQVANWFINARVR 451
                              664459******************************88 PP

2BELL100.11.7e-32280351172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              er +l++k +kL sll++Vd  Ykqy+e +q+++ssFe++aglg+a+pYt+lAlk+iS +FrcL dai++qi
  Itr_sc000021.1_g00046.1 280 ERYDLESKMTKLFSLLDKVDMSYKQYYEHMQVLVSSFEMIAGLGAARPYTALALKTISCQFRCLCDAIKKQI 351
                              67899******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-39202349IPR006563POX domain
PfamPF075266.0E-39208347IPR006563POX domain
PROSITE profilePS5007112.001392455IPR001356Homeobox domain
SMARTSM003891.0E-9395459IPR001356Homeobox domain
CDDcd000862.53E-12395456No hitNo description
SuperFamilySSF466892.99E-17399462IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-28400461IPR009057Homeodomain-like
PfamPF059202.9E-17412451IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MATYYSGLTN QRDALPLLPD QKHTSFQSGV PGGVMFLNHP STPLAYPELS PNNNAEVQSI  60
RSGDEMLLLS PTSDLLNMQQ PVGSLLNGGS GSMEANAFSS KPFDMQNVEQ NLQYQGLSLS  120
LAMEVPSSVQ VPSYHDQYRN SGFSSLLTQG SQYNEDKSVE YLSFDLAGDH QNGVKVGAMD  180
NLESSIGLRE VNFSAHLHEA TATSAASIYN CKYLKAAQDL LDEVVNVQSA KKQADKQNHF  240
SFVQNGSEET EVKSSCSVPG MASDLQKSTD ISSAELSATE RYDLESKMTK LFSLLDKVDM  300
SYKQYYEHMQ VLVSSFEMIA GLGAARPYTA LALKTISCQF RCLCDAIKKQ IQITRQSLGE  360
QGNSQGERLY RLRHVDQQLR QQRLLQQFGV MRQPWRPLRG LPENAVSILR AWLFEHFLHP  420
YPKDSEKVTL ARQTGLTRSQ VANWFINARV RLWKPMIEEM YKEEVGDAEA GSTASPPEQI  480
RAAATEKSAS EDTADKELQE SLTGDYSCIQ QYSDVRTNNV PDHLLDASRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17401458158Homeobox protein Meis1
4xrs_B7e-17401458158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238265.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010320402.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010320401.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9SIW11e-101BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLK4BVF80.0K4BVF8_SOLLC; Uncharacterized protein
STRINGSolyc04g080790.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-90BEL1-like homeodomain 7